Anti-ING1

inhibitor of growth family member 1, Polyclonal, IgG, Rabbit

GeneName: ING1

Concentration: 0,2

Sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK

InterspeciesReactivity: ENSMUSG00000045969: 78%, ENSRNOG00000014520: 77%

Entrez Gene ID: 3621

Uniprot ID: Q9UK53

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal ING1 Antibody against Human inhibitor of growth family member 1. Validated for Western Blot

• SKU: ATLHPA068363-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA068363-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 3621
• Host: Rabbit
• Conjugate: Unconjugated