Anti-JMJD6

jumonji domain containing 6, arginine demethylase and lysine hydroxylase, Polyclonal, IgG, Rabbit

Sequence: MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA

GeneName: JMJD6

Ensembl Gene ID: ENSG00000070495

UniProt ID: Q6NYC1

Entrez Gene ID: 23210

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.3

Interspecies Mouse/Rat: ENSMUSG00000056962: 93%, ENSRNOG00000000250: 95%

Enhanced Validation: No

• SKU: ATLHPA074031-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA074031-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 23210
• Host: Rabbit
• Conjugate: Unconjugated