Anti-LNX2

ligand of numb-protein X 2, Polyclonal, IgG, Rabbit

GeneName: LNX2

Concentration: 0,2

Sequence: SVCKDVMQRCDLEAHLKNRCPGASHRRVALERRKTSRTQAEIENENGPTLLDPAGTLSPEADCLGTGAVPVERHLTSAS

InterspeciesReactivity: ENSMUSG00000016520: 75%, ENSRNOG00000000955: 68%

Entrez Gene ID: 222484

Uniprot ID: Q8N448

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal LNX2 Antibody against Human ligand of numb-protein X 2. Validated for Western Blot

• SKU: ATLHPA071073-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA071073-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 222484
• Host: Rabbit
• Conjugate: Unconjugated