Anti-MCTP1

multiple C2 and transmembrane domain containing 1, Polyclonal, IgG, Rabbit

Sequence: MLDSCKLKSACNLPFICNKKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSD

GeneName: MCTP1

Ensembl Gene ID: ENSG00000175471

UniProt ID: Q6DN14

Entrez Gene ID: 79772

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000021596: 82%, ENSRNOG00000013282: 63%

Enhanced Validation: No

• SKU: ATLHPA075887-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA075887-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 79772
• Host: Rabbit
• Conjugate: Unconjugated