Anti-NUSAP1

nucleolar and spindle associated protein 1, Polyclonal, IgG, Rabbit

Sequence: THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ

GeneName: NUSAP1

Ensembl Gene ID: ENSG00000137804

UniProt ID: Q9BXS6

Entrez Gene ID: 51203

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.3

Interspecies Mouse/Rat: ENSRNOG00000004921: 76%, ENSMUSG00000027306: 76%

Enhanced Validation: No

• SKU: ATLHPA074847-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA074847-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry, Chromatin Immunoprecipitation (ChIP), ChIP-Exo-Seq
• Isotype: IgG
• Human Gene ID: 51203
• Host: Rabbit
• Conjugate: Unconjugated