CloneID: AbAb02OPG
Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).
Buffer Composition: PBS with 0.02% Proclin 300.
Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7
Uniprot Accession No.: O00300
Specificity Statement: This antibody is specific for the C-terminal epitope of OPG.
Application Notes (Clone): This antibody was generated as a detection antibody that binds to the C-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding capture antibody (AbAb01OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A).
English
Deutsch
