Anti-OPG (AbAb02OPG)

Anti-OPG [AbAb02OPG], Recombinant, IgG1 kappa, Mouse
SKU
ABAAb04114-1.1-BT
Packaging Unit
1 mg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: AbAb02OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).

Buffer Composition: PBS only.

Uniprot Accession No.: O00300

Specificity Statement: This antibody is specific for the C-terminal epitope of OPG.

Application Notes (Clone): This antibody was generated as a detection antibody that binds to the C-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding capture antibody (AbAb01OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A).
More Information
SKU ABAAb04114-1.1-BT
Manufacturer Absolute Antibody
Manufacturer SKU Ab04114-1.1-BT
Package Unit 1 mg
Quantity Unit STK
Reactivity Human
Clonality Recombinant
Application ELISA
Isotype IgG1 kappa
Host Mouse
Product information (PDF) Download
MSDS (PDF) Download