Anti-OPG (AbAb02OPG)

Anti-OPG [AbAb02OPG], Recombinant, IgG kappa, Rabbit

CloneID: AbAb02OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).

Buffer Composition: PBS only.

Uniprot Accession No.: O00300

Specificity Statement: This antibody is specific for the C-terminal epitope of OPG.

Application Notes (Clone): This antibody was generated as a detection antibody that binds to the C-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding capture antibody (AbAb01OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A).

• SKU: ABAAb04114-23.0-BT
• Manufacturer: Absolute Antibody
• Manufacturer SKU: Ab04114-23.0-BT
• Package Unit: 1 mg
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Recombinant
• Application: ELISA
• Isotype: IgG kappa
• Host: Rabbit