Anti-PGAP1

post-GPI attachment to proteins 1, Polyclonal, IgG, Rabbit

Sequence: HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST

GeneName: PGAP1

Ensembl Gene ID: ENSG00000197121

UniProt ID: Q75T13

Entrez Gene ID: 80055

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000073678: 89%, ENSRNOG00000013388: 91%

Enhanced Validation: No

• SKU: ATLHPA069704-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA069704-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 80055
• Host: Rabbit
• Conjugate: Unconjugated