Anti-Phospholipase A2 (AbAb02-PLA2)

Anti-Phospholipase A2 [AbAb02-PLA2], Recombinant, VHH, Camelid
SKU
ABAAb04531-34.11-BS
Packaging Unit
1 mg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: AbAb02-PLA2

Heavy Chain modification: His-tagged

Antigen Long Description: A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA'.

Buffer Composition: PBS only.

Specificity Statement: This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait).

Application Notes (Clone): This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA.
More Information
SKU ABAAb04531-34.11-BS
Manufacturer Absolute Antibody
Manufacturer SKU Ab04531-34.11-BS
Package Unit 1 mg
Quantity Unit STK
Reactivity Various species
Clonality Recombinant
Application ELISA
Isotype VHH
Host Camelid
Product information (PDF)
×
MSDS (PDF) Download