Anti-PIAS2

protein inhibitor of activated STAT 2, Polyclonal, IgG, Rabbit

GeneName: PIAS2

Concentration: 0,1

Sequence: MRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVI

InterspeciesReactivity: ENSMUSG00000025423: 89%, ENSRNOG00000017493: 89%

Entrez Gene ID: 9063

Uniprot ID: O75928

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal PIAS2 Antibody against Human protein inhibitor of activated STAT 2. Validated for Western Blot

• SKU: ATLHPA070620-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA070620-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 9063
• Host: Rabbit
• Conjugate: Unconjugated