Anti-PIAS4

protein inhibitor of activated STAT 4, Polyclonal, IgG, Rabbit

Sequence: PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA

GeneName: PIAS4

Ensembl Gene ID: ENSG00000105229

UniProt ID: Q8N2W9

Entrez Gene ID: 51588

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000004934: 79%, ENSRNOG00000020230: 80%

Enhanced Validation: No

• SKU: ATLHPA076008-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA076008-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 51588
• Host: Rabbit
• Conjugate: Unconjugated