Anti-PLEKHG3

pleckstrin homology and RhoGEF domain containing G3, Polyclonal, IgG, Rabbit

Sequence: SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA

GeneName: PLEKHG3

Ensembl Gene ID: ENSG00000126822

UniProt ID: A1L390

Entrez Gene ID: 26030

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSRNOG00000006570: 60%, ENSMUSG00000052609: 69%

Enhanced Validation: Yes

• SKU: ATLHPA074734-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA074734-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 26030
• Host: Rabbit
• Conjugate: Unconjugated