Anti-POT1

protection of telomeres 1, Polyclonal, IgG, Rabbit

GeneName: POT1

Concentration: 0,1

Sequence: RLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTANQHSDV

InterspeciesReactivity: ENSMUSG00000098835: 76%, ENSRNOG00000047439: 76%

Entrez Gene ID: 25913

Uniprot ID: Q9NUX5

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal POT1 Antibody against Human protection of telomeres 1. Validated for Western Blot

• SKU: ATLHPA078046-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA078046-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 25913
• Host: Rabbit
• Conjugate: Unconjugated