Anti-POT1

protection of telomeres 1, Polyclonal, IgG, Rabbit

Sequence: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR

GeneName: POT1

Ensembl Gene ID: ENSG00000128513

UniProt ID: Q9NUX5

Entrez Gene ID: 25913

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000098835: 76%, ENSRNOG00000019986: 74%

Enhanced Validation: No

• SKU: ATLHPA068538-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA068538-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 25913
• Host: Rabbit
• Conjugate: Unconjugated