Anti-PYHIN1

pyrin and HIN domain family member 1, Polyclonal, IgG, Rabbit

Sequence: SSSFTKKDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAV

GeneName: PYHIN1

Ensembl Gene ID: ENSG00000163564

UniProt ID: Q6K0P9

Entrez Gene ID: 149628

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Enhanced Validation: Yes

• SKU: ATLHPA055373-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA055373-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 149628
• Host: Rabbit
• Conjugate: Unconjugated