Anti-RALGPS1

Ral GEF with PH domain and SH3 binding motif 1, Polyclonal, IgG, Rabbit

Sequence: NMMCQLSVVESKSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLES

GeneName: RALGPS1

Ensembl Gene ID: ENSG00000136828

UniProt ID: Q5JS13

Entrez Gene ID: 9649

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000038831: 92%, ENSRNOG00000016910: 90%

Enhanced Validation: No

• SKU: ATLHPA014749-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA014749-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 9649
• Host: Rabbit
• Conjugate: Unconjugated