Anti-RGS13

regulator of G protein signaling 13, Polyclonal, IgG, Rabbit

Sequence: TYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

GeneName: RGS13

Ensembl Gene ID: ENSG00000127074

UniProt ID: O14921

Entrez Gene ID: 6003

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSMUSG00000051079: 84%, ENSRNOG00000003888: 83%

Enhanced Validation: Yes

• SKU: ATLHPA076656-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA076656-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 6003
• Host: Rabbit
• Conjugate: Unconjugated