Anti-SCAPER

S-phase cyclin A associated protein in the ER, Polyclonal, IgG, Rabbit

Sequence: KVKAHHTGSTASSEITPAQSCPPMTVQKASRKNERKDAEGWETVQRGRPIRSRSTAVMPKVSLATEATRSKDDSDKENVCLLPDESIQKGQFVGDGTSNTIESHPKDSLHSCDHPLA

GeneName: SCAPER

Ensembl Gene ID: ENSG00000140386

UniProt ID: Q9BY12

Entrez Gene ID: 49855

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSMUSG00000034007: 76%, ENSRNOG00000006864: 75%

Enhanced Validation: No

• SKU: ATLHPA048077-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA048077-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 49855
• Host: Rabbit
• Conjugate: Unconjugated