Anti-SOCS5

suppressor of cytokine signaling 5, Polyclonal, IgG, Rabbit

GeneName: SOCS5

Concentration: 0,3

Sequence: HSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKP

InterspeciesReactivity: ENSMUSG00000037104: 93%, ENSRNOG00000028504: 95%

Entrez Gene ID: 9655

Uniprot ID: O75159

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal SOCS5 Antibody against Human suppressor of cytokine signaling 5. Validated for Western Blot

• SKU: ATLHPA031964-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA031964-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 9655
• Host: Rabbit
• Conjugate: Unconjugated