Anti-SPG7

spastic paraplegia 7 (pure and complicated autosomal recessive), Polyclonal, IgG, Rabbit

GeneName: SPG7

Concentration: 0,1

Sequence: RKVTRIAYSMVKQFGMAPGIGPISFPEAQEGLMGIGRRPFSQGLQQMMDHEARLLVAKAYRHTEKVLQDNLDKL

InterspeciesReactivity: ENSMUSG00000000738: 95%, ENSRNOG00000015150: 93%

Entrez Gene ID: 6687

Uniprot ID: Q9UQ90

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal SPG7 Antibody against Human SPG7 matrix AAA peptidase subunit, paraplegin. Validated for Western Blot

• SKU: ATLHPA076114-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA076114-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 6687
• Host: Rabbit
• Conjugate: Unconjugated