Anti-TOGARAM2

TOG array regulator of axonemal microtubules 2, Polyclonal, IgG, Rabbit

Sequence: FSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLAVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQ

GeneName: TOGARAM2

Ensembl Gene ID: ENSG00000189350

UniProt ID: Q6ZUX3

Entrez Gene ID: 165186

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSRNOG00000026344: 85%, ENSMUSG00000045761: 87%

Enhanced Validation: No

• SKU: ATLHPA075216-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA075216-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 165186
• Host: Rabbit
• Conjugate: Unconjugated