Anti-UACA

uveal autoantigen with coiled-coil domains and ankyrin repeats, Polyclonal, IgG, Rabbit

Sequence: MTLNDTLAKTNRELLDVKKKFEDINQEFVKIKDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKK

GeneName: UACA

Ensembl Gene ID: ENSG00000137831

UniProt ID: Q9BZF9

Entrez Gene ID: 55075

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.4

Interspecies Mouse/Rat: ENSMUSG00000034485: 61%, ENSRNOG00000012868: 60%

Enhanced Validation: No

• SKU: ATLHPA056006-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA056006-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 55075
• Host: Rabbit
• Conjugate: Unconjugated