Anti-WSB1

WD repeat and SOCS box containing 1, Polyclonal, IgG, Rabbit

GeneName: WSB1

Concentration: 0,05

Sequence: SYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVA

InterspeciesReactivity: ENSMUSG00000017677: 93%, ENSRNOG00000012929: 89%

Entrez Gene ID: 26118

Uniprot ID: Q9Y6I7

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal WSB1 Antibody against Human WD repeat and SOCS box containing 1. Validated for Western Blot

• SKU: ATLHPA067752-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA067752-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 26118
• Host: Rabbit
• Conjugate: Unconjugated