Anti-WSB2

WD repeat and SOCS box containing 2, Polyclonal, IgG, Rabbit

GeneName: WSB2

Concentration: 0,05

Sequence: ALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMK

InterspeciesReactivity: ENSMUSG00000029364: 96%, ENSRNOG00000001135: 96%

Entrez Gene ID: 55884

Uniprot ID: Q9NYS7

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal WSB2 Antibody against Human WD repeat and SOCS box containing 2. Validated for Western Blot

• SKU: ATLHPA077139-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA077139-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 55884
• Host: Rabbit
• Conjugate: Unconjugated