Anti-WWC1

WW and C2 domain containing 1, Polyclonal, IgG, Rabbit

GeneName: WWC1

Concentration: 0,05

Sequence: SGVYEASVQRLGASEAAAFDSDESEAVGATRIQIALKYDEKNKQFAILIIQLSNLSAL

InterspeciesReactivity: ENSMUSG00000018849: 91%, ENSRNOG00000008065: 88%

Entrez Gene ID: 23286

Uniprot ID: Q8IX03

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal WWC1 Antibody against Human WW and C2 domain containing 1. Validated for Western Blot

• SKU: ATLHPA066092-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA066092-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 23286
• Host: Rabbit
• Conjugate: Unconjugated