Anti-ZBTB9

zinc finger and BTB domain containing 9, Polyclonal, IgG, Rabbit

Sequence: DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT

GeneName: ZBTB9

Ensembl Gene ID: ENSG00000213588

UniProt ID: Q96C00

Entrez Gene ID: 221504

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.3

Interspecies Mouse/Rat: ENSMUSG00000079605: 86%, ENSRNOG00000026799: 85%

Enhanced Validation: No

• SKU: ATLHPA058171-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA058171-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 221504
• Host: Rabbit
• Conjugate: Unconjugated