Anti-ZNRF2

zinc and ring finger 2, Polyclonal, IgG, Rabbit

Sequence: NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK

GeneName: ZNRF2

Ensembl Gene ID: ENSG00000180233

UniProt ID: Q8NHG8

Entrez Gene ID: 223082

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSRNOG00000049057: 86%, ENSMUSG00000058446: 84%

Enhanced Validation: No

• SKU: ATLHPA072244-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA072244-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 223082
• Host: Rabbit
• Conjugate: Unconjugated