AP2B1 Antibody - middle region : HRP

AP2B1 Antibody - middle region : HRP
SKU
AVIARP53576_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: AP2B1is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AP2B1

Key Reference: Schmid,E.M., PLoS Biol. 4 (9), E262 (2006)

Molecular Weight: 105kDa

Peptide Sequence: Synthetic peptide located within the following region: SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: AP-2 complex subunit beta

Protein Size: 951

Purification: Affinity Purified

Subunit: beta
More Information
SKU AVIARP53576_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53576_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 163
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×