APBB1IP Antibody - N-terminal region : Biotin

APBB1IP Antibody - N-terminal region : Biotin
SKU
AVIARP57312_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APBB1IP

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 precursor protein-binding family B member 1-interacting protein

Protein Size: 666

Purification: Affinity Purified
More Information
SKU AVIARP57312_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57312_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54518
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×