APH1B Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a multi-pass transmembrane protein that is a functional component of the gamma-secretase complex, which also contains presenilin and nicastrin. This protein represents a stabilizing cofactor for the presenilin holoprotein in the complex. The gamma-secretase complex catalyzes the cleavage of integral proteins such as notch receptors and beta-amyloid precursor protein.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-secretase subunit APH-1B

Protein Size: 216

Purification: Affinity Purified

Subunit: APH-1B

• SKU: AVIARP53808_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53808_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 83464
• Host: Rabbit
• Conjugate: Conjugated, FITC