APIP Antibody - N-terminal region : Biotin

APIP Antibody - N-terminal region : Biotin
SKU
AVIARP56788_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human APIP

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable methylthioribulose-1-phosphate dehydratase

Protein Size: 204

Purification: Affinity Purified
More Information
SKU AVIARP56788_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56788_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51074
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×