Apoa1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Apoa1 is a major component of high density lipoprotein (HDL) that is involved in intercellular cholesterol transport in astrocytes; cofactor for lecithin cholesterolacyltransferase (LCAT)。

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: LVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein A-I

Protein Size: 259

Purification: Affinity Purified

• SKU: AVIARP54279_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54279_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 25081
• Host: Rabbit
• Conjugate: Conjugated, Biotin