APOA4 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The gene encoding APOA4 protein contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human APOA4

Key Reference: Penco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein A-IV

Protein Size: 396

Purification: Affinity Purified

• SKU: AVIARP54316_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54316_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 337
• Host: Rabbit
• Conjugate: Conjugated, Biotin