APOC2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human APOC2

Key Reference: N/A

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: ESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Apolipoprotein C-II

Protein Size: 101

Purification: Affinity purified

• SKU: AVIARP54318_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54318_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 344
• Host: Rabbit
• Conjugate: Conjugated, HRP