APPL1 Antibody - middle region : FITC

APPL1 Antibody - middle region : FITC
SKU
AVIARP54834_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APPL1

Key Reference: McCrea,H.J., (2008) Biochem. Biophys. Res. Commun. 369 (2), 493-499

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DCC-interacting protein 13-alpha

Protein Size: 709

Purification: Affinity Purified
More Information
SKU AVIARP54834_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54834_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26060
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×