AQP5 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AQP5

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aquaporin-5

Protein Size: 265

Purification: Affinity Purified

• SKU: AVIARP53592_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53592_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 362
• Host: Rabbit
• Conjugate: Conjugated, Biotin