ARFIP1 Antibody - C-terminal region : Biotin

ARFIP1 Antibody - C-terminal region : Biotin
SKU
AVIARP54460_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ARFIP1 is a putative target protein of ADP-ribosylation factor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARFIP1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arfaptin-1

Protein Size: 373

Purification: Affinity Purified
More Information
SKU AVIARP54460_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54460_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27236
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×