ARG2 Antibody - N-terminal region : Biotin

ARG2 Antibody - N-terminal region : Biotin
SKU
AVIARP54566_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARG2

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arginase-2, mitochondrial

Protein Size: 354

Purification: Affinity Purified
More Information
SKU AVIARP54566_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54566_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 384
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×