ARHGAP1 Antibody - N-terminal region : HRP

ARHGAP1 Antibody - N-terminal region : HRP
SKU
AVIARP54722_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARHGAP1 is a GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho GTPase-activating protein 1

Protein Size: 439

Purification: Affinity Purified
More Information
SKU AVIARP54722_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54722_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 392
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×