ARHGAP15 Antibody - middle region : HRP

ARHGAP15 Antibody - middle region : HRP
SKU
AVIARP57262_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP15

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho GTPase-activating protein 15

Protein Size: 475

Purification: Affinity Purified
More Information
SKU AVIARP57262_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57262_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55843
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×