ARHGAP28 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARHGAP28

Key Reference: Nusbaum,C., (2005) Nature 437 (7058), 551-555

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 28

Protein Size: 563

Purification: Affinity Purified

• SKU: AVIARP53789_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53789_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79822
• Host: Rabbit
• Conjugate: Conjugated, FITC