ARHGAP28 Antibody - N-terminal region : HRP

ARHGAP28 Antibody - N-terminal region : HRP
SKU
AVIARP53570_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP28

Key Reference: Nusbaum,C., (2005) Nature 437 (7058), 551-555

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: KEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho GTPase-activating protein 28

Protein Size: 570

Purification: Affinity Purified
More Information
SKU AVIARP53570_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53570_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79822
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×