ARHGAP45 Antibody - N-terminal region : Biotin

ARHGAP45 Antibody - N-terminal region : Biotin
SKU
AVIARP54876_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human HMHA1

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: rho GTPase-activating protein 45

Protein Size: 771

Purification: Affinity Purified
More Information
SKU AVIARP54876_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54876_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23526
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×