ARL17 Antibody - middle region : Biotin

ARL17 Antibody - middle region : Biotin
SKU
AVIARP56258_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL17

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosylation factor-like protein 17

Protein Size: 177

Purification: Affinity Purified
More Information
SKU AVIARP56258_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56258_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 641522
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×