ARL8B Antibody - middle region : FITC

ARL8B Antibody - middle region : FITC
SKU
AVIARP57137_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARL8B may play a role in lysosome motility and chromosome segregation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL8B

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosylation factor-like protein 8B

Protein Size: 186

Purification: Affinity Purified
More Information
SKU AVIARP57137_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57137_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55207
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×