ARMC8 Antibody - N-terminal region : HRP

ARMC8 Antibody - N-terminal region : HRP
SKU
AVIARP56018_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of ARMC8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARMC8

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Armadillo repeat-containing protein 8

Protein Size: 385

Purification: Affinity Purified
More Information
SKU AVIARP56018_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56018_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25852
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×