Arsg Antibody - middle region : Biotin

Arsg Antibody - middle region : Biotin
SKU
AVIARP55121_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Arsg displays arylsulfatase activity with pseudosubstrates at acidic pH, such as p-nitrocatechol sulfate.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Arsg

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: LAEVLQQAGYVTAMIGKWHLGHHGSYHPSFRGFDYYFGIPYSNDMGCTDN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arylsulfatase G

Protein Size: 526

Purification: Affinity Purified
More Information
SKU AVIARP55121_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55121_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 303631
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×