ASAH1 Antibody - middle region : HRP

ASAH1 Antibody - middle region : HRP
SKU
AVIARP57761_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASAH1

Key Reference: Kim,H.L. (2008) Genetics 178 (3), 1505-1515

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acid ceramidase

Protein Size: 395

Purification: Affinity Purified
More Information
SKU AVIARP57761_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57761_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 427
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×