ASPA Antibody - N-terminal region : Biotin

ASPA Antibody - N-terminal region : Biotin
SKU
AVIARP56072_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of SASP is not yet known.This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASPA

Key Reference: Le (2008) Biochemistry 47 (11), 3484-3492

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aspartoacylase

Protein Size: 313

Purification: Affinity Purified
More Information
SKU AVIARP56072_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56072_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 443
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×